Specials

Full-length rhCDC7 and DBF4 proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDC7 is a cell division cycle 7 homolog protein that is critical for the G1/S transition and is also essential for initiation of DNA replication as cell division occurs. CDC7 is expressed in many normal tissues, but the overexpression of CDC7 may be associated with neoplastic transformation for some tumors and transformed cell lines. CDC7/DBF4 kinase promotes S phase by alleviating an inhibitory activity in Mcm4 that evolved to integrate several protein kinase. Kinase Enzyme System contains: Kinase: CDC7/DBF4, 10microg (Human, recombinant full-length). MW: ~94kDa (CDC7) and ~125kDa (DBF4). Substrate: PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC); derived from two human proteins: residues 1-14 are based on AKT1 (307-320), and residues 16-39 are based on PKN2/PRK2 (961-984). Other: Reaction Buffer, DTT. CDC7/DBF4 NCBI Database Entry: www.ncbi.nlm.nih.gov/gene/8317/.