CDK9/CyclinK Kinase Enzyme System

Full-length rhCDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9/CyclinK is a member of the cyclin-dependent protein kinase family. CDK9 is closely related to cdc28 and cdc2 and is a key regulator of the cell cycle; is a component of the multiprotein complex TAK/P-TEF beta; can modulate RNA polymerase II-directed transcription by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II; forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K; interacts with the HIV-1 Tat protein. Kinase Enzyme System contains: Kinase: CDK9/CyclinK, 10ug (Human, recombinant full-length). MW: ~68kDa (CDK9) and ~67kDa (CyclinK). Substrate: PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC); residues 1-14 are derived from AKT1 (307-320), and residues 16-39 are derived from PKN2/PRK2 (961-984). Other: Reaction Buffer, DTT. CDK9/CyclinK NCBI Database Entry: www.ncbi.nlm.nih.gov/gene/1025/.