PRKG1 (PKG) Kinase Enzyme System

Full-length rhPRKG1 (PKG) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. PRKG1 is a homodimer, with each monomer containing a regulatory cGMP-binding domain and a catalytic domain (1). PRKG1 was shown to be expressed at highest levels in bladder, uterus, adrenal gland and fallopian tube. PRKG1 plays an important stimulatory role in platelet activation (2). Expression of recombinant PRKG1 in a reconstituted cell model enhanced von Willebrand factor-induced activation of the platelet integrin alpha-IIb/beta-3. PRKG1 knockout mice showed impaired platelet responses to VWF or low doses of thrombin and prolonged bleeding time. Kinase: PDK1, 10ug (Human, recombinant full-length). MW: ~67kDa. Substrate: PDKtide ([protein fragment, 39 aa]); derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984). Reaction Buffer: DTT. PDK1 NCBI Database Entry: www.ncbi.nlm.nih.gov/gene/5170/.